Gluten Free Sweet Potato Pancakes Recipe
30-MINUTE MEALS! Get the email series now
Royal Recipe

Gluten Free Sweet Potato Pancakes

5 from 1 vote
1 Comments
Emma Carter
By: Emma CarterUpdated: Sep 20, 2026
This post may contain affiliate links. Please read our disclosure policy.

Fluffy, naturally sweet pancakes made with pureed sweet potato and a gluten-free flour blend — dairy-free, vegan, and perfect for cozy breakfasts.

Gluten Free Sweet Potato Pancakes

This recipe for gluten free sweet potato pancakes has been a weekday savior and weekend treat in my kitchen for years. I first developed it on a chilly autumn morning when I had leftover mashed sweet potato and a pantry full of gluten-free flour blends. The result was a stack of pancakes that were tender inside with a delicate crisp edge and a warm spice profile from cinnamon and nutmeg. They quickly became one of those recipes I reach for when I want something comforting that also feels a little special.

What makes these pancakes stand out is the texture and the balance of flavors. The sweet potato puree adds natural moisture and sweetness so the batter needs less sugar, while ground flax acts as a binder in place of eggs and gives a subtle nutty note. I love serving them with warm maple syrup and a smear of dairy-free yogurt; my family smiles the first time they bite into one and then asks for more. These pancakes are reliably fluffy, hold together well while cooking, and make an excellent make-ahead breakfast for busy mornings.

Why You'll Love This Recipe

  • Ready in about 30 minutes from start to finish when you have cooked sweet potato on hand; the batter comes together quickly and cooks in small batches for fresh, hot pancakes.
  • Uses pantry staples like a gluten-free flour blend, ground flax, and maple syrup so you rarely need a special grocery trip; great for building from what you already have.
  • Dairy-free and vegan by design when you use plant milk and coconut oil, making it accessible for many dietary needs without sacrificing texture or flavor.
  • The sweet potato adds natural sweetness, moisture, and a tender crumb so you can reduce added sweeteners; it also contributes beta carotene and color.
  • Make-ahead friendly: the batter holds for a short rest and cooked pancakes reheat beautifully in a low oven, making them ideal for batch breakfasts or brunch crowds.

When I serve these at weekend brunches, friends often ask how they are so tender yet not soggy. The trick is the balance of wet-to-dry ingredients and a hot, well-seasoned pan. My partner once declared them the best pancakes I have ever made, which is high praise in our household where breakfast is serious business.

Ingredients

  • Unsweetened dairy-free milk (1 1/2 cups): I usually use unsweetened almond milk or oat milk for a neutral taste; choose a brand you like for best flavor and consistency. The milk hydrates the flour blend and thins the batter so the pancakes cook through evenly.
  • Pureed sweet potato (1/2 cup): Use cooked and mashed or canned sweet potato puree. I prefer baking a sweet potato until tender, removing the skin, and mashing until smooth. This adds natural sweetness and moisture and keeps the crumb tender.
  • Coconut oil (3 tablespoons): Use melted coconut oil or any neutral-flavored oil like avocado or light olive oil; it adds richness and helps the pancakes brown.
  • Pure vanilla extract (1 teaspoon): Adds aroma and rounds out the sweetness. Use a high-quality pure vanilla for the best flavor.
  • Ground flax seeds (2 tablespoons): Acts as an egg replacement and binder. Freshly ground flax yields a better texture; stir into the wet ingredients and let rest so it gels slightly.
  • Pure maple syrup (2 tablespoons): Adds a gentle sweetness and depth of flavor. Grade A or amber maple gives a pleasant maple note without overpowering the sweet potato.
  • Gluten-free flour blend (2 cups): Use a 1-to-1 baking blend with xanthan gum included for structure; if yours lacks xanthan, add 1/4 teaspoon per cup. Brands I use include Bob's Red Mill 1-to-1 or King Arthur Measure for Measure.
  • Baking powder (1 tablespoon) and baking soda (1/2 teaspoon): Provide lift and slight browning; make sure your leavening is fresh for the best rise.
  • Ground cinnamon (1 1/4 teaspoons) and ground nutmeg (3/4 teaspoon): Warm spices that complement the sweet potato. Adjust to taste if you prefer more or less spice.
  • Salt (1/4 teaspoon): Balances sweetness and enhances flavor. Use fine sea salt for even distribution.

Instructions

Prepare the wet mix: Whisk together 1 1/2 cups unsweetened dairy-free milk, 1/2 cup pureed sweet potato, 3 tablespoons melted coconut oil, 1 teaspoon vanilla extract, 2 tablespoons ground flax seeds, and 2 tablespoons pure maple syrup in a medium bowl. Whisk long enough to incorporate the flax thoroughly and let the mixture sit for 5 minutes so the flax can absorb some liquid and thicken slightly, improving binding. Preheat the pan: Heat a skillet or nonstick pan over medium-high heat for at least 2 minutes. The pan should feel hot to the touch but not smoking. If using a cast iron skillet, allow 3 minutes so heat distributes evenly. Aim for a cooking surface temperature around 350 to 375 degrees Fahrenheit; a drop of water should sizzle and evaporate quickly. Mix dry ingredients: In a large bowl whisk together 2 cups gluten-free flour blend, 1 tablespoon baking powder, 1/2 teaspoon baking soda, 1 1/4 teaspoons ground cinnamon, 3/4 teaspoon ground nutmeg, and 1/4 teaspoon salt. Whisking aerates the flour and distributes leavening agents evenly so the pancakes rise uniformly. Combine wet and dry: Slowly pour the wet mixture into the dry ingredients, stirring gently until just incorporated. Avoid overmixing; small lumps are fine and help produce a tender texture. If the batter seems too thick, add up to 1 tablespoon additional dairy-free milk to reach a pourable consistency. Cook the pancakes: Lightly oil the pan with a thin film of coconut oil. Using a ladle, pour about 1/3 cup of batter into the center of the pan for each pancake; for smaller pancakes use a 2-tablespoon measure. Reduce the heat to medium and cook until bubbles form on the surface and the edges look set, about 2 to 3 minutes. Flip carefully with a spatula and cook 1 1/2 to 2 minutes more until golden brown and cooked through. If the pancake browns too quickly, lower the heat slightly. Keep warm and serve: Place finished pancakes on a covered, oven-safe plate in a 200 degree Fahrenheit oven while you cook the remaining batter to keep them warm and soft. Serve warm with additional maple syrup, dairy-free yogurt, toasted nuts, or fresh fruit. Stack of gluten free sweet potato pancakes

You Must Know

  • These pancakes freeze well for up to 3 months. Cool completely, arrange between parchment sheets, store in an airtight container, and reheat from frozen in a low oven or toaster oven.
  • They are naturally high in beta carotene from sweet potato and provide moderate fiber from ground flax and the flour blend; the pancakes are a wholesome breakfast option when paired with protein-rich toppings.
  • Allowing the flax to hydrate for 5 minutes improves binding and texture — don’t skip this step if you want pancakes that hold together when flipping.
  • Use a gluten-free blend labeled 1-to-1 for best results; blends without binders may produce fragile pancakes unless you add xanthan gum.

My favorite thing about this recipe is how forgiving it is. One morning I accidentally used slightly more milk and the batter was thinner; a quick reduction in heat and a slightly longer cook time fixed it and the pancakes were still tender. Friends and family have remarked that these pancakes feel indulgent yet lighter than traditional pancakes, which makes them a repeat request at weekend breakfasts.

Cooking pancakes on skillet

Storage Tips

Store leftover pancakes in an airtight container in the refrigerator for up to 3 days. To prevent sogginess, place a paper towel between layers to absorb excess moisture. For longer storage, cool completely and freeze flat on a baking sheet before transferring to a freezer-safe bag; separate stacks with parchment paper. Reheat refrigerated pancakes in a 300 degree Fahrenheit oven for 8 to 10 minutes or frozen pancakes for 12 to 15 minutes, flipping halfway, until warmed through and slightly crisp at the edges.

Ingredient Substitutions

If you do not have coconut oil, use melted avocado oil or light olive oil; avoid extra-virgin olive oil as its strong flavor may compete with the spices. Swap almond milk for oat or soy milk if you prefer a creamier texture. If your gluten-free blend lacks xanthan gum, add 1/2 teaspoon to the dry ingredients to improve structure. For a slightly different flavor, use roasted pumpkin puree instead of sweet potato at a 1:1 ratio.

Serving Suggestions

These pancakes work well with simple maple syrup and a pat of dairy-free butter, or dress them up with cinnamon-spiced apples, toasted pecans, and a dollop of coconut yogurt. For a savory-sweet contrast, serve with a smear of ricotta (or plant-based ricotta) and a drizzle of honey or maple syrup. They make a lovely centerpiece for a fall brunch paired with smoked almonds and a side of fruit salad.

Cultural Background

Pancakes have myriad global variations, and incorporating sweet potato into batter is a tradition seen in multiple cuisines where root vegetables are used to add moisture and flavor. This adaptation blends North American pancake techniques with the practical use of tubers, reflecting a pragmatic home-cooking approach that values both nutrition and comfort. Using gluten-free blends and plant milks modernizes the recipe for contemporary dietary needs while keeping the spirit of a simple, stovetop breakfast.

Seasonal Adaptations

In autumn and winter, boost the spice with a pinch of ground cloves or allspice and top with caramelized pears. For spring, lighten the batter by adding lemon zest and serving with a berry compote. During holidays, add a splash of spiced rum to the maple syrup for adults or fold chopped toasted pecans into the batter for texture and festive crunch.

Meal Prep Tips

For meal prep, double the batch and cool pancakes completely before stacking between parchment sheets. Portion into zip-top bags for grab-and-go breakfasts. Reheat in the oven or toaster oven to retain crispness; microwaving is faster but can soften the exterior. To freeze batter, scoop onto a lined tray and freeze until solid, then transfer to a bag and cook from frozen at a slightly lower heat until cooked through.

These pancakes have a warm, homey quality that makes mornings feel special. Whether you serve them for a leisurely weekend brunch or assemble them quickly on a busy weekday, they welcome customization and make it easy to please a crowd. Take your time with the pan temperature and let the batter rest — those two small steps are what turn good pancakes into great ones.

Pro Tips

  • Let the ground flax hydrate in the wet ingredients for 5 minutes to act as an effective binder and improve texture.

  • Preheat your pan thoroughly and use medium heat for cooking; adjust slightly lower if the pancakes brown too fast.

  • Use a thin film of oil and wipe excess with a paper towel between batches to prevent smoking and excess oil transfer.

This nourishing gluten free sweet potato pancakes recipe is sure to be a staple in your kitchen. Enjoy every moist, high protein slice — it is perfect for breakfast or as a wholesome snack any time.

FAQs about Recipes

Can I use a gluten-free flour without xanthan gum?

Yes. If your gluten-free flour blend does not contain a binder like xanthan gum, add 1/4 teaspoon xanthan gum per cup of flour used to improve structure.

What is the best way to reheat these pancakes?

Reheat in a 300°F oven for 8-10 minutes for refrigerated pancakes or 12-15 minutes for frozen. Flip once halfway through to evenly warm.

Tags

Breakfastgluten-freebreakfastpancakesrecipesvegetariansweet-potato
No ratings yet

Gluten Free Sweet Potato Pancakes

This Gluten Free Sweet Potato Pancakes recipe makes perfectly juicy, tender, and flavorful steak every time! Serve with potatoes and a side salad for an unforgettable dinner in under 30 minutes.

Servings: 8 steaks
Gluten Free Sweet Potato Pancakes
Prep:10 minutes
Cook:15 minutes
Rest Time:10 mins
Total:25 minutes

Ingredients

Main

Instructions

1

Mix wet ingredients and rest

Whisk milk, sweet potato puree, melted oil, vanilla, ground flax, and maple syrup together in a medium bowl until combined. Let sit for 5 minutes to thicken as the flax hydrates.

2

Preheat pan

Heat a nonstick skillet or cast iron pan over medium-high heat for at least 2 minutes until it reaches about 350-375°F on the surface. Reduce to medium before cooking.

3

Combine dry ingredients

Whisk together the gluten-free flour blend, baking powder, baking soda, cinnamon, nutmeg, and salt in a large bowl to aerate and evenly distribute leavening.

4

Combine wet and dry

Slowly pour wet ingredients into dry and stir until just incorporated. Do not overmix; small lumps are fine. Adjust thickness with up to 1 tablespoon more milk if needed.

5

Cook pancakes

Lightly oil the pan and ladle about 1/3 cup batter per pancake. Cook until bubbles form and edges set, 2-3 minutes, then flip and cook 1 1/2-2 minutes until golden and cooked through.

6

Keep warm and serve

Place cooked pancakes on a covered oven-safe plate in a 200°F oven while finishing the batch. Serve warm with maple syrup, dairy-free yogurt, or fruit.

Last Step: Please leave a rating and comment letting us know how you liked this recipe! This helps our business to thrive and continue providing free, high-quality recipes for you.

Nutrition

Calories: 270kcal | Carbohydrates: 30g | Protein:
6g | Fat: 16g | Saturated Fat: 5g |
Polyunsaturated Fat: 3g | Monounsaturated Fat:
6g | Trans Fat: 1g | Cholesterol: 253mg | Sodium:
0mg | Potassium: 953mg | Fiber: 0g | Sugar:
0g | Vitamin A: 577IU | Vitamin C: 3mg | Calcium:
47mg | Iron: 6mg

Did You Make This?

Leave a comment & rating below or tag
@royalmorsel on social media!

Gluten Free Sweet Potato Pancakes

Categories:

Gluten Free Sweet Potato Pancakes

Did You Make This?

Leave a comment & rating below or tag @royalmorsel on social media!

Rate This Recipe

Share This Recipe

Enjoyed this recipe? Share it with friends and family, and don't forget to leave a review!

Comments (1)

Leave a Comment

0/1000 characters
Food Lover
1 day ago

This recipe looks amazing! Can't wait to try it.

Rating:

Comments are stored locally in your browser. Server comments are displayed alongside your local comments.

Family photo

Hi, I'm Emma!

Chef and recipe creator specializing in delicious Breakfast cooking. Passionate about sharing easy-to-follow recipes that bring families together around the dinner table.

30-Minute Meals!

Join to receive our email series which contains a round-up of some of our quick and easy family favorite recipes.